DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG31220

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:277 Identity:86/277 - (31%)
Similarity:128/277 - (46%) Gaps:43/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PNCGIRTMPSFHRTRIIGGSDAEITSHPWMA-YLYNEFHYF---------CAGTLITNQFVLTAA 81
            |:||   .|. ...|:|||::..:..:||:| .||.....|         |.|:||..::|||||
  Fly    93 PDCG---KPQ-TTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAA 153

  Fly    82 HCIEAS--KNLTVRLG-------GSGLTRSDGSMCQITAEDYSVSMAIKHKYFTPS--IMLNDIA 135
            ||:..:  :...||||       ...::|....:|..|..|..|.....|..:.|:  ...||||
  Fly   154 HCVTDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIA 218

  Fly   136 MIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGW---GLADKRMHPHLLQEAPITVMNR 197
            ::||...|::.....|||::..|  |.|::  ..:...||   |:.|  ....:|:.|.:.|...
  Fly   219 LVRLKEPVRYTMAYYPICVLDYP--RSLMK--FKMYVAGWGKTGMFD--TGSKVLKHAAVKVRKP 277

  Fly   198 NVCSKLYDVAI--TQGQICAGDKET-NTCLGDSGGPLGGVV-NYYGDLRFVQYGITSFGDIECRS 258
            ..||:.|....  .:.|||||..:. .||.||||.||.|.. ..|..:.|:. ||||:|. .|.:
  Fly   278 EECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLA-GITSYGG-PCGT 340

  Fly   259 ---PSIYTDLSTYSGWI 272
               ||::|..:.:..||
  Fly   341 IGWPSVFTRTAKFYKWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 80/261 (31%)
Tryp_SPc 42..275 CDD:238113 81/262 (31%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 80/261 (31%)
Tryp_SPc 104..360 CDD:238113 81/262 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463679
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.