DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG8952

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:251 Identity:66/251 - (26%)
Similarity:121/251 - (48%) Gaps:38/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RIIGGSDAEITSHPWMAYLYNEF--HYFCAGTLITNQFVLTAAHCIEASKNLTVRLGGSGLTRSD 103
            ||:.||||::...||...|..:.  ...|.|::|::.:|||||||.....::.:..|...|..::
  Fly    37 RIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHCTNGLSSIFLMFGTVDLFNAN 101

  Fly   104 GSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLLEDGM 168
                   |.:.:.:..|.|..:...:. ||:::|:|...:.|..:|:        |::|:.:.|.
  Fly   102 -------ALNMTSNNIIIHPDYNDKLN-NDVSLIQLPEPLTFSANIQ--------AIQLVGQYGD 150

  Fly   169 TL-----MAT--GWGLADKRM--HPHLLQEAPITVMNRNVCSKLY-DVAITQGQICA---GDKET 220
            ::     :||  |:|..:...  :...|..|.:.:::...|..:| ...:....:||   ...:.
  Fly   151 SIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVDSTMCAKGFDGSDM 215

  Fly   221 NTCLGDSGGPLGGVVNYYGDL-RFVQYGITSF-GDIEC--RSPSIYTDLSTYSGWI 272
            :||.|||||||   :.|...: ::.|.||.|| .:.:|  |.||.|..:|::.|:|
  Fly   216 STCTGDSGGPL---ILYNKTIQQWQQIGINSFVAEDQCTYRLPSGYARVSSFLGFI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 65/249 (26%)
Tryp_SPc 42..275 CDD:238113 65/250 (26%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 65/249 (26%)
Tryp_SPc 38..271 CDD:238113 65/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436492
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.