DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG31205

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:267 Identity:67/267 - (25%)
Similarity:109/267 - (40%) Gaps:36/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIRTMPSFHRTRIIGGSDAEITSHPWMAYLY-----NEFHYFCAGTLITNQFVLTAAHCIEASK 88
            |||.....::...||    ||.|.|||:..:.     ......|.|.||.::.|:|||||:  ||
  Fly    29 CGIFNEKQYNSDNII----AEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCV--SK 87

  Fly    89 NLTVRLGGSGLTRSDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPIC 153
            :.:..:.|.....||.|...:      ||....|..::|....||:|:|.|.:.|.|.|.::|||
  Fly    88 DESESIYGVVFGDSDSSNINL------VSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPIC 146

  Fly   154 IILDPAVRLLLEDGMT----LMATGW-GLADKRMHPHLLQ-----EAPITVMNRNVCSKLYDVAI 208
            :   |:|..::....|    |:..|. |.:..|.|....:     :...|.::...|.: .....
  Fly   147 L---PSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKECHE-KQARF 207

  Fly   209 TQGQICAGDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIECRSPSIYTDLSTYSGWIN 273
            .:..|| |..|.:...|.:.....|....:..|.....|..| .|::.:.   |.::..:..||:
  Fly   208 PEELIC-GHTERSPLSGSALTEASGTPRQFHLLGIAVAGFFS-SDLDHQG---YLNIRPHLDWIS 267

  Fly   274 MVVSQYR 280
            ...|:.|
  Fly   268 KNSSKLR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 60/245 (24%)
Tryp_SPc 42..275 CDD:238113 62/247 (25%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 41/134 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.