DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG33458

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:265 Identity:89/265 - (33%)
Similarity:141/265 - (53%) Gaps:17/265 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GESRLLEPNCGIRTMPSFHRTRIIGGSDAEITSHPWMAYLYNEFHYFCAGTLITNQFVLTAAHCI 84
            |.|.|||.:|||    |.:..||.||.|:.:..:||:|||:....:.|.|:|:.:.||||||||.
  Fly    20 GYSYLLEWDCGI----SKYTYRITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHWFVLTAAHCF 80

  Fly    85 -EASKNLTVRLGGSGLTRS---DGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKF 145
             :.:..:.||||.:..::.   :.|.|.....:|.:...:.|..:. :....|||:.:|.|.|.:
  Fly    81 RDKNAKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLYR-TAHYYDIALAKLNRYVVY 144

  Fly   146 YDHIRPICIILDPAVRLLLEDGMTLMATGWGLADKRMHPHLLQEAPITVMNRNVCSKLYDVAITQ 210
            .|.|||||::|:|..::.::.....:.||||..:.......||...|..::|..|...:...:.:
  Fly   145 TDSIRPICLMLNPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQIDRFTCRYWFGYMVDR 209

  Fly   211 GQICAGDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIECRSP----SIYTDLSTYSGW 271
            ..||||:.:.....||||||||.:|:|....||.|:||.|    ..|.|    |::|::.:||.|
  Fly   210 THICAGESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVS----HLRQPFHGVSVFTNILSYSNW 270

  Fly   272 INMVV 276
            |:..:
  Fly   271 IHRTI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 78/238 (33%)
Tryp_SPc 42..275 CDD:238113 79/240 (33%)
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 78/238 (33%)
Tryp_SPc 38..274 CDD:238113 79/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.