DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG33461

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:264 Identity:103/264 - (39%)
Similarity:144/264 - (54%) Gaps:9/264 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SRLLEPNCGIRTMPSFHRTRIIGGSDAEITSHPWMAYLYNEFHYFCAGTLITNQFVLTAAHCIEA 86
            |..||.|||:....|:   :||.|:.|.:..:||||:|:...::.|||:||...||||:|||||.
  Fly    25 SVFLEENCGVVPRLSY---KIINGTPARLGRYPWMAFLHTPTYFLCAGSLINQWFVLTSAHCIED 86

  Fly    87 SKNLTVRLGGSGLTRS---DGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDH 148
            ...|..|||.:.....   :.:.|....::|:|.|..||:.:.|....|||.|:||.|.|::..|
  Fly    87 DVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYH 151

  Fly   149 IRPICIILDPAVRLLLEDGMTLMATGWGLADKRMH---PHLLQEAPITVMNRNVCSKLYDVAITQ 210
            |:||||.....::|:::......||||||....::   ..:|.|..:....||.|::::......
  Fly   152 IQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLS 216

  Fly   211 GQICAGDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIECRSPSIYTDLSTYSGWINMV 275
            ||||||:.:.|.|.||||||.|..|..:|..||||.||.||....|...||.||:..|..||..|
  Fly   217 GQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCSKVSILTDVVRYGRWIKKV 281

  Fly   276 VSQY 279
            |..|
  Fly   282 VDWY 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 91/236 (39%)
Tryp_SPc 42..275 CDD:238113 93/238 (39%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 91/236 (39%)
Tryp_SPc 42..281 CDD:238113 93/238 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463343
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
98.790

Return to query results.
Submit another query.