DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG30323

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:239 Identity:49/239 - (20%)
Similarity:83/239 - (34%) Gaps:88/239 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 HYFCAGTLITNQFVLTAAHCIEASKNLTVRLGGSGLTRSDGSMCQITAEDYSVSMAIKHKYFTPS 128
            ::||||:|::..:|:|:..|:.              ||.:.     |....|....::...|||.
  Fly    51 NHFCAGSLLSAWWVVTSGCCVS--------------TRPES-----TPNQPSNRKNLRVVVFTPK 96

  Fly   129 IMLNDIAMIRLAR-TVKFYDHIRPICIILDPA--------VRLLLEDGMT------------LMA 172
                     ||.: :.|...|::.  |:||.:        ..|.|:.|:|            |.:
  Fly    97 ---------RLKKPSPKNIYHVQK--IVLDESAISGCTELALLKLDRGVTGQRFAMMLPEKELNS 150

  Fly   173 T------GWGLADKRMHPHLLQEAPITVMNRNVCSKLYDVAITQGQICAGDKETNTCLGDSGGPL 231
            |      |||......:.::....|       ..|.:||..:|..|               .|| 
  Fly   151 TWLCNSLGWGRIYYVSYVYISAMCP-------AFSMVYDNPVTWFQ---------------DGP- 192

  Fly   232 GGVVNYYGDLRFVQYGITSFGDIECRSP-SIYTDLSTYSGWINM 274
                 |..:|  :|.......:.||:.. |....:::|:|..||
  Fly   193 -----YSSEL--IQIRAQKISEYECKPDCSRCLCMTSYTGRGNM 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 47/235 (20%)
Tryp_SPc 42..275 CDD:238113 49/239 (21%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 49/239 (21%)
Tryp_SPc 45..272 CDD:214473 49/239 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436690
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.