DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG30289

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:269 Identity:88/269 - (32%)
Similarity:141/269 - (52%) Gaps:22/269 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SRLLEPNCGIRT----MPSFHRTRIIGGSDAEITSHPWMAYLYNEFHYFCAGTLITNQFVLTAAH 82
            ||||..||||..    :|:     |.||:...|..:|||..:::...  |.|:||..||||||||
  Fly    23 SRLLVENCGISKDDPYVPN-----IFGGAKTNIQENPWMVLVWSSKP--CGGSLIARQFVLTAAH 80

  Fly    83 CIEASKNLTVRLGG----SGLTRSDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTV 143
            |: :.::|.||||.    ..:.....:.|.....:.||.|.|.|:.:....:.||||::|::..|
  Fly    81 CV-SFEDLYVRLGDYETLDPMPYCLNNHCIPKFYNISVDMKIVHENYNGITLQNDIALLRMSEAV 144

  Fly   144 KFYDHIRPICIILDPAVRLLLEDGMTLMATGWGLADKRMHPHLLQEAPITVMNRNVCSKLYDVAI 208
            ::.|::||||:::...::.:    .....||||..:......:|..|.:..|:.:.|:..::...
  Fly   145 EYSDYVRPICLLVGEQMQSI----PMFTVTGWGETEYGQFSRILLNATLYNMDISYCNIKFNKQA 205

  Fly   209 TQGQICAGDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIECRS--PSIYTDLSTYSGW 271
            .:.|||||...:|||.|||||||....:|...|...|||:.|:|...|.:  ..:||::|.:..|
  Fly   206 DRSQICAGSHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERCAANVAGVYTNVSYHREW 270

  Fly   272 INMVVSQYR 280
            |...:.|::
  Fly   271 IFNKMVQFK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 76/236 (32%)
Tryp_SPc 42..275 CDD:238113 78/238 (33%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 76/235 (32%)
Tryp_SPc 42..271 CDD:238113 76/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.770

Return to query results.
Submit another query.