DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG30287

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:294 Identity:89/294 - (30%)
Similarity:149/294 - (50%) Gaps:42/294 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AAFLVIISVCQWLCRFGESRLLEPNC-GIRTMPSFHRTRIIGGSDAEITSHPWMAYLYNEFHYFC 67
            |..|:::....:|...|:..||:|.| ..|:.|..:  |:|.|..|::.|:|||..:.......|
  Fly     5 AVQLLLLIALVFLKVQGQPHLLDPQCVTARSEPGLY--RVINGKPADLFSNPWMVIIIERGMMKC 67

  Fly    68 AGTLITNQFVLTAAHC-IEASKNLTVRLGGSGLTRSDGSMCQITAEDYSVSMAIK---------- 121
            .|:|||.::||||||| .|....||||||                 ||.|:.|:.          
  Fly    68 GGSLITPRYVLTAAHCKSETKSQLTVRLG-----------------DYDVNQAVDCSSYGCIPRP 115

  Fly   122 -----HKYFTPS----IMLNDIAMIRLARTVKFYDHIRPICIILDPAV--RLLLEDGMTLMATGW 175
                 .:.:.||    ...||||::||..||::.|:||.||:::....  ..:|::.:....|||
  Fly   116 REINVTRTYVPSHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGW 180

  Fly   176 GLADKRMHPHLLQEAPITVMNRNVCSKLYDVAITQGQICAGDKETNTCLGDSGGPLGGVVNYYGD 240
            |..:.|::..:||:|.:|..:.:.|::::...:.:..||......:||.|||||||...|....:
  Fly   181 GRTESRINSPVLQQASLTHHHLSYCAQVFGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSE 245

  Fly   241 LRFVQYGITSFGDIECRSPSIYTDLSTYSGWINM 274
            .|.:.:|:.|:|.:.|..|::||::..::.||.:
  Fly   246 RRVILFGVVSYGAVHCFGPTVYTNVIHFANWIEL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 77/252 (31%)
Tryp_SPc 42..275 CDD:238113 78/255 (31%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 77/252 (31%)
Tryp_SPc 42..280 CDD:238113 78/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.