DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG30286

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:274 Identity:102/274 - (37%)
Similarity:160/274 - (58%) Gaps:8/274 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVIISVCQWLCRFGESRLLEPNCGIRTMPSFHRTRIIGGSDAEITSHPWMAYLYNEFHYFCAGTL 71
            |::.|:..| .....::.|||:||..:..:.....    ..|.|:..||||||:......|.|||
  Fly     5 LLLTSLLPW-HPHATAQFLEPDCGYMSPEALQNEE----HQAHISESPWMAYLHKSGELVCGGTL 64

  Fly    72 ITNQFVLTAAHCIEASKNLTVRLGG-SGLTRSD--GSMCQITAEDYSVSMAIKHKYFTPSIMLND 133
            :.::|:|||||||...:|||||||. :.||..|  ||.|...:||:.:.:|.:|..::.:..::|
  Fly    65 VNHRFILTAAHCIREDENLTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNRIHD 129

  Fly   134 IAMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWGLADKRMHPHLLQEAPITVMNRN 198
            |.::|||::|::..||:|||:|.:..::..:|....|:|||||.:......|:|:...:|.:|..
  Fly   130 IGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLHRLVATGWGRSPSEAANHILKSIRVTRVNWG 194

  Fly   199 VCSKLYDVAITQGQICAGDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIECRSPSIYT 263
            ||||.|.|...:.|||...:...:|.||||||:|..:...|.:.|||.||.|:|:.||.|||::|
  Fly   195 VCSKTYWVDRRRDQICVSHESGVSCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAECLSPSVFT 259

  Fly   264 DLSTYSGWINMVVS 277
            ::..:..||...:|
  Fly   260 NVMEHIDWIMAALS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 91/233 (39%)
Tryp_SPc 42..275 CDD:238113 93/235 (40%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 92/229 (40%)
Tryp_SPc 39..268 CDD:214473 91/228 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463281
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.