DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG30187

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:275 Identity:97/275 - (35%)
Similarity:135/275 - (49%) Gaps:16/275 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVIISVCQWLCR-FGESRLLEPNCGIRTMPSFHRTRIIGGSDAEITSHPWMAYLYNEFHYFCAGT 70
            |..|.|..|..: .|.|..|:..|||..     ..:|.||.:|...:..|||.::|..|:.|.||
  Fly     5 LAWIPVIFWFLKDVGASIFLDQICGINI-----ALKITGGHNAAFQNSVWMAAVHNRTHFICGGT 64

  Fly    71 LITNQFVLTAAHCIEASKNLTVRLGGSGLTRSDGSMCQITAEDYSVSMAIKHKYF-TPSIMLNDI 134
            ||..:|||||||||......:|.||  ...:||      .|:...|..|:.|..| ..:...|||
  Fly    65 LIHKRFVLTAAHCIVDQDVQSVSLG--AYNKSD------PADRKDVITAVVHSSFDVRASYENDI 121

  Fly   135 AMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWGLADKRMHPHLLQEAPITVMNRNV 199
            .:::|:..|.|...||||||:|:.::...:.:..|..|.|||.........:||...:..::|..
  Fly   122 GLLKLSSDVIFNALIRPICIVLNKSMANHMRNMRTFKAFGWGTLRGNKTSDILQTIILNHLDREE 186

  Fly   200 CSKLYDVAITQGQICAGDKETNTCLGDSGGPLGGVVNYYG-DLRFVQYGITSFGDIECRSPSIYT 263
            |.....|..::.|||||....:||.|||||||...|...| ..|.||:||.|.|...|....:||
  Fly   187 CYMELSVYPSEKQICAGVPSGDTCGGDSGGPLTNDVFIQGIGNREVQFGIISVGKTSCDGQGVYT 251

  Fly   264 DLSTYSGWINMVVSQ 278
            ||.:::.||.|.:.:
  Fly   252 DLMSFADWIKMTIER 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 84/232 (36%)
Tryp_SPc 42..275 CDD:238113 86/234 (37%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 84/232 (36%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.