DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG30098

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:269 Identity:96/269 - (35%)
Similarity:136/269 - (50%) Gaps:25/269 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLVIISVCQWLCRFGESRLLEPNCGIRTMPSFHRTRIIGGSDAEITSHPWMAYLYNEFHYFCAGT 70
            ||||::    |..:|.|:||:..|     .:..|.|:|||.:|..|  ||||||..:..:.|.|:
  Fly    10 FLVILT----LGSYGYSQLLDSKC-----IALFRIRVIGGQNARRT--PWMAYLIRDNRFACGGS 63

  Fly    71 LITNQFVLTAAHCIEASKNLTVRLGGSGLTR-SDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDI 134
            ||..:||||||||.:.:.||.||||....:| :||.     ...|.|....:||.:. ....:||
  Fly    64 LIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQ-----TRSYRVVSIYRHKNYI-DFRNHDI 122

  Fly   135 AMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWG-LADKRMHPHLLQEAPITVMNRN 198
            |:::|.|.|.:..:||||||:|:..::.|.........|||| :|.....|..|||..:..:...
  Fly   123 AVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNE 187

  Fly   199 VCSKLYDVAITQGQICAGDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIECRSPSIYT 263
            .|      .:....||..:.....|.||||||||.:|.|.....:||:|:|:.....|...|.|.
  Fly   188 YC------GVPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSSYL 246

  Fly   264 DLSTYSGWI 272
            ||.:|..|:
  Fly   247 DLMSYMPWL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 84/232 (36%)
Tryp_SPc 42..275 CDD:238113 84/233 (36%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 84/231 (36%)
Tryp_SPc 37..258 CDD:238113 84/233 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463452
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.740

Return to query results.
Submit another query.