DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG30002

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:268 Identity:89/268 - (33%)
Similarity:133/268 - (49%) Gaps:26/268 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLEPNCGIRT--MPSFH-RTRIIGGSDAEITSHPWMAYLY--NEFHYF-CAGTLITNQFVLTAAH 82
            |.:.:||:|:  :|:.. |..|.||..:.:.|.||||:|:  ::.... |.|:||:..|||||||
  Fly    41 LTQQDCGVRSNQIPAVRIRFMITGGRKSSLMSQPWMAFLHIASDLEMCRCGGSLISELFVLTAAH 105

  Fly    83 CIE---ASKNLTVRLGGSGLTRSDG-------SMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMI 137
            |.:   .||.:.|.||...|:.:..       .:|....|::::...|.|:.|.......|||:|
  Fly   106 CFKMCPRSKEIRVWLGELDLSSTSDCTTYNYERVCAPPVEEFTIDKWILHEEFNLFYPGYDIALI 170

  Fly   138 RLARTVKFYDHIRPICI-ILDPAVRLLLEDGMTLMATGWGLADKRMHPHLLQEAPITVMNRNVCS 201
            :|.:.|.|.|||||||: :.|..:...|:.|...||.|||..:...:.:...|..|   ....|:
  Fly   171 KLNKKVVFKDHIRPICLPLTDELLAFTLQLGQRFMAVGWGKTESLRYANSTMEVDI---RTEKCT 232

  Fly   202 KLYDVAITQGQICAGDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIECRS--PSIYTD 264
            ...|.:.    :||.....:||.|||||||......:|..|.||:|:.|.|...|.:  .:.|.|
  Fly   233 DGRDTSF----LCASGDYVDTCNGDSGGPLLWKTTLFGKDRAVQFGVVSTGSQNCGAGHKAYYMD 293

  Fly   265 LSTYSGWI 272
            :.||..||
  Fly   294 VPTYMPWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 81/246 (33%)
Tryp_SPc 42..275 CDD:238113 83/247 (34%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 81/245 (33%)
Tryp_SPc 62..301 CDD:238113 81/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.