DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and try-4

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:316 Identity:68/316 - (21%)
Similarity:118/316 - (37%) Gaps:99/316 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ESRLLEPNCGIRTMPSFHRTRIIGGSDAEITSHPWMAYLYNEFHYFCAGTLITNQFVLTAAHCIE 85
            ::.:|..:|||:             .:::|.:.||......:......|::|:...::||||   
 Worm    39 DNEVLMESCGIQ-------------QESKIKNFPWAVSFTVDGVNRLGGSIISPYHIITAAH--- 87

  Fly    86 ASKNLTVRLGGSGLTRSDGSMCQ---ITAEDYSVSMAIK-------------------HKY---- 124
               .....:|      |.|::|:   ....:.|:..:||                   .||    
 Worm    88 ---GFITTIG------SRGNLCENKNWKKPNSSIYRSIKFLRDTRKVAYGGTCIRGHTDKYPNDP 143

  Fly   125 --------------------FTPSIML--NDIAMIRLARTVKFYDHIRPICIILDPAVRLLLEDG 167
                                |..|..|  :|.|::.:.:.:.|.:::||||:   |...:...  
 Worm   144 RCKKSDVIHNKVRAVLVDGEFASSNCLKGHDWAIVEVEKRIHFSENVRPICL---PRPNMYYT-- 203

  Fly   168 MTLMATGWGLA--DKRMHPHLLQEAPITVMNRNVCSKLYD---VAITQGQICAGDKETN------ 221
            .:|...|||.:  .....| |:.|.|:.: :|: |.:.:.   .|.....|||.....:      
 Worm   204 KSLAVPGWGRSYIFNESGP-LIHEIPMRI-DRD-CKRPWSDRLPADADDFICATSMNVSNYSAPR 265

  Fly   222 TCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIECRSPSI--YTDLSTYSGWINMV 275
            ||.|||||.|....:.||  |.....|||||...|.|..:  :|.:..|   :|::
 Worm   266 TCHGDSGGGLEYRDDNYG--RAFLIAITSFGTRGCPSNMLARFTRVDMY---LNLI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 63/291 (22%)
Tryp_SPc 42..275 CDD:238113 64/293 (22%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 64/291 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.