DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43335 and CG43742

DIOPT Version :9

Sequence 1:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:274 Identity:100/274 - (36%)
Similarity:143/274 - (52%) Gaps:27/274 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVIISVCQWLCRFGESRLLEPNCGIRTMPSFHRTRIIGGSDAEITSHPWMAYLYNEFHYFCAGTL 71
            |::::|..:...|  ::||:.||.::.     ..|:..|..| |||. :||.|||...:||.|:|
  Fly     7 LLLVAVVIYQNAF--AQLLDENCKVKI-----TYRVANGHTA-ITSQ-FMAALYNNSEFFCGGSL 62

  Fly    72 ITNQFVLTAAHCIEASKNLTVRLGGSGLTRSDGSMCQITAEDYSVSM---AIKHKYFTPSIMLND 133
            |..|:|||||||:.....:||.||      .:...|.|....:.:.:   .|.|..|..:|.|||
  Fly    63 IHKQYVLTAAHCVRDLDEVTVHLG------ENNRSCPIPVCKHVLRLNAKVILHPNFHGNIFLND 121

  Fly   134 IAMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWGLADKRMHPHLLQEAPITVMNRN 198
            ||::||.|.|.|..||||||||||..|....::..|  |.|||..:......:|....:..:.::
  Fly   122 IALLRLEREVIFEAHIRPICIILDEDVTSNNQNNFT--AYGWGKTEHGNISDVLSFIDLVRLPKS 184

  Fly   199 VCSKLYDVAITQGQICAGDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIECRSP-SIY 262
            :|.:..:.      ||||....:||..||||||.|...:.|..|.:.:||||:||.||... .:|
  Fly   185 MCYQNINT------ICAGSTSGDTCESDSGGPLIGNFVHRGKSRDILFGITSYGDAECSGLFGVY 243

  Fly   263 TDLSTYSGWINMVV 276
            ||::.|..||..||
  Fly   244 TDVNAYKSWIASVV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 89/234 (38%)
Tryp_SPc 42..275 CDD:238113 90/236 (38%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 89/234 (38%)
Tryp_SPc 35..256 CDD:238113 90/236 (38%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463450
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.