DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43397 and CG42733

DIOPT Version :10

Sequence 1:NP_001246249.1 Gene:CG43397 / 12798394 FlyBaseID:FBgn0263271 Length:40 Species:Drosophila melanogaster
Sequence 2:NP_001188902.1 Gene:CG42733 / 36093 FlyBaseID:FBgn0261686 Length:97 Species:Drosophila melanogaster


Alignment Length:44 Identity:20/44 - (45%)
Similarity:28/44 - (63%) Gaps:4/44 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHLMCERLSAVFAGVLVGLWYGKTF----SEDEKPKEKGKDKKK 40
            |.::|:||||:.||.:||:||.:.|    ..|...|:|.|||.|
  Fly     1 MRMLCDRLSALTAGAMVGVWYAQNFPCENPTDGGDKDKAKDKAK 44

Return to query results.
Submit another query.