DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43069 and nfatc2ip

DIOPT Version :10

Sequence 1:NP_001246412.1 Gene:CG43069 / 12798338 FlyBaseID:FBgn0262479 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001072535.1 Gene:nfatc2ip / 779990 XenbaseID:XB-GENE-6457267 Length:434 Species:Xenopus tropicalis


Alignment Length:51 Identity:16/51 - (31%)
Similarity:33/51 - (64%) Gaps:2/51 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QPLAALLRQKYAQAFGVATESLI-LAFDGEKIQEEDTFDSLAMEDNDIVDV 75
            :||.:|:.| |..|.|:..:..: ..|:|:|::.::|.:.|.:|.:||::|
 Frog   383 EPLQSLMDQ-YQAAMGLTKKHKVSFFFEGQKLKGKNTAEELGLESDDIIEV 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43069NP_001246412.1 Ubl_SUMO_like 7..76 CDD:340462 16/51 (31%)
nfatc2ipNP_001072535.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63
PHA03247 <26..213 CDD:223021
SPRR2 <26..63 CDD:434240
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..237
Ubl_SLD1_NFATC2ip 275..348 CDD:340598
Ubl_SLD2_NFATC2ip 360..433 CDD:340599 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.