DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43069 and nfatc2ip

DIOPT Version :10

Sequence 1:NP_001246412.1 Gene:CG43069 / 12798338 FlyBaseID:FBgn0262479 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001314685.2 Gene:nfatc2ip / 337574 ZFINID:ZDB-GENE-030131-9520 Length:353 Species:Danio rerio


Alignment Length:50 Identity:16/50 - (32%)
Similarity:25/50 - (50%) Gaps:2/50 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PLAALLRQKYAQAFGV-ATESLILAFDGEKIQEEDTFDSLAMEDNDIVDV 75
            |:.::|.| |..:..| |.......|||.::....|...|.|||.|:::|
Zfish   303 PIGSILSQ-YVSSLDVSARRRAKFLFDGSRVSNNQTPAELDMEDGDVIEV 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43069NP_001246412.1 Ubl_SUMO_like 7..76 CDD:340462 15/49 (31%)
nfatc2ipNP_001314685.2 None

Return to query results.
Submit another query.