DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43069 and pmt3

DIOPT Version :10

Sequence 1:NP_001246412.1 Gene:CG43069 / 12798338 FlyBaseID:FBgn0262479 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001342889.1 Gene:pmt3 / 2540927 PomBaseID:SPBC365.06 Length:117 Species:Schizosaccharomyces pombe


Alignment Length:47 Identity:17/47 - (36%)
Similarity:24/47 - (51%) Gaps:0/47 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LRQKYAQAFGVATESLILAFDGEKIQEEDTFDSLAMEDNDIVDVVEE 78
            |.:.|....|.:..||....|||:|:.:.|...|.|||.|.::.|.|
pombe    61 LMKIYCARQGKSMNSLRFLVDGERIRPDQTPAELDMEDGDQIEAVLE 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43069NP_001246412.1 Ubl_SUMO_like 7..76 CDD:340462 15/43 (35%)
pmt3NP_001342889.1 SMT3 1..114 CDD:227552 17/47 (36%)

Return to query results.
Submit another query.