DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43324 and Gng7

DIOPT Version :10

Sequence 1:NP_001246399.1 Gene:CG43324 / 12798331 FlyBaseID:FBgn0263029 Length:66 Species:Drosophila melanogaster
Sequence 2:NP_034449.3 Gene:Gng7 / 14708 MGIID:95787 Length:68 Species:Mus musculus


Alignment Length:63 Identity:27/63 - (42%)
Similarity:35/63 - (55%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NLQQQRSINLQLRREVEMERMPVSVACSLMMKYMLEHEEEDCLLSGFTQKVNPFREKSSCSIL 66
            |:.|.|.:..|||.|..:||:.||.|.|.:|.|..:|...|.||.|.....|||::|..|.||
Mouse     6 NVAQARKLVEQLRIEAGIERIKVSKASSDLMGYCEQHARNDPLLVGVPASENPFKDKKPCIIL 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43324NP_001246399.1 GGL 5..61 CDD:238024 22/55 (40%)
Gng7NP_034449.3 GGL 7..68 CDD:128520 24/60 (40%)

Return to query results.
Submit another query.