DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43324 and Gng4

DIOPT Version :10

Sequence 1:NP_001246399.1 Gene:CG43324 / 12798331 FlyBaseID:FBgn0263029 Length:66 Species:Drosophila melanogaster
Sequence 2:NP_034447.1 Gene:Gng4 / 14706 MGIID:102703 Length:75 Species:Mus musculus


Alignment Length:64 Identity:25/64 - (39%)
Similarity:34/64 - (53%) Gaps:1/64 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NLQQQRSINLQLRREVEMERMPVSVACSLMMKYMLEHEEEDCLLSGFTQKVNPFREKS-SCSIL 66
            ::.|.|....||:.|..|:|:.||.|.|.::.|...|..||.|:.......||||||. .|:||
Mouse    12 SISQARKAVEQLKMEACMDRVKVSQAASDLLAYCEAHVREDPLIIPVPASENPFREKKFFCTIL 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43324NP_001246399.1 GGL 5..61 CDD:238024 21/55 (38%)
Gng4NP_034447.1 GGL 13..75 CDD:128520 23/61 (38%)

Return to query results.
Submit another query.