DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43324 and GNG14

DIOPT Version :10

Sequence 1:NP_001246399.1 Gene:CG43324 / 12798331 FlyBaseID:FBgn0263029 Length:66 Species:Drosophila melanogaster
Sequence 2:NP_001303621.1 Gene:GNG14 / 105372280 HGNCID:53439 Length:107 Species:Homo sapiens


Alignment Length:34 Identity:11/34 - (32%)
Similarity:17/34 - (50%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 MMKYMLEHEEEDCLLSGFTQKVNPFREKSSCSIL 66
            ::|:..|..:.|..|.|.....|.|:||...:||
Human    74 LLKFCTEQAKNDPFLVGIPAATNSFKEKKPYAIL 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43324NP_001246399.1 GGL 5..61 CDD:238024 8/27 (30%)
GNG14NP_001303621.1 GGL 18..103 CDD:469600 9/28 (32%)

Return to query results.
Submit another query.