DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43324 and dact3

DIOPT Version :10

Sequence 1:NP_001246399.1 Gene:CG43324 / 12798331 FlyBaseID:FBgn0263029 Length:66 Species:Drosophila melanogaster
Sequence 2:XP_002932675.1 Gene:dact3 / 100489837 XenbaseID:XB-GENE-22068343 Length:421 Species:Xenopus tropicalis


Alignment Length:58 Identity:15/58 - (25%)
Similarity:26/58 - (44%) Gaps:8/58 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LQQQRSINLQLRREVEMERMPVSVACSLMMKYMLEHEEEDCLLSGFTQKVNPFREKSS 62
            ||....::.||   .|:||.    ...|.::...::|..:|...|. :..:.|.|:||
 Frog    42 LQGGEDLDRQL---WELERQ----LGELRLRAENDNENVECEADGM-EASDVFVERSS 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43324NP_001246399.1 GGL 5..61 CDD:238024 13/55 (24%)
dact3XP_002932675.1 Dapper <377..421 CDD:464605
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.