DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG34409

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:284 Identity:80/284 - (28%)
Similarity:119/284 - (41%) Gaps:57/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QPCGKTPVPKIISGSNASQQSAQYMAGI------FNTTHLLCGGTIIHEDFVLTVAHC-----KS 79
            |.||.....:::.|..||.....::..|      .:.....|.|::|..:.::|.|||     ..
  Fly   240 QGCGINVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSD 304

  Fly    80 TQTLFVRLGAYNINHPTDQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHLDA- 143
            .:...||||:.:...|   ..:.:.|.||.|....|||||||:::..:   |....|||:..:. 
  Fly   305 LELSHVRLGSQDGATP---FAIEQVIVHPNYDQPKYANDIALLRINST---NGTFTPICLPFNGP 363

  Fly   144 -TLGKQI--RYYNAFGW--GRTRNAEQSD---------ILQRIFVNRTNPMICHLYLGMSPD--- 191
             |||.::  :...|.||  |.|.|....|         .::...||.|:..|.  |..:|.:   
  Fly   364 ITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIA--YASLSENFQQ 426

  Fly   192 -----PKQICATTDQG----DTCAGDSGGPLISKIT---YQGKNFDTQFGITSYGTRECNGV--- 241
                 |..:||   ||    |.|.||||||.:...|   :......|..||.::|...| ||   
  Fly   427 PIVITPNHLCA---QGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFGPTLC-GVTTI 487

  Fly   242 -GLYTDVSQYSGWIANIVRSKQDR 264
             |:||.||.:|.||...:....|:
  Fly   488 PGVYTLVSSFSDWILRSIAEGSDQ 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 74/263 (28%)
Tryp_SPc 36..257 CDD:238113 76/265 (29%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 74/263 (28%)
Tryp_SPc 252..501 CDD:238113 74/260 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463494
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.