DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and proz

DIOPT Version :10

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001116189.1 Gene:proz / 496781 XenbaseID:XB-GENE-971425 Length:416 Species:Xenopus tropicalis


Alignment Length:88 Identity:24/88 - (27%)
Similarity:44/88 - (50%) Gaps:9/88 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QRQLKKAETMLQSMIDKINHELNQLVVEELQIKSRDAQL-SVETTTAKMVKPDPLLDVATCSTAE 78
            :|..|:...:::||::| |..|....:|.|:|...|.|| ::....::|...|..||....:...
 Frog   296 ERYPKELNAIMESMLNK-NPSLRPSAIEILKIPYLDEQLQNLMCRYSEMTLEDKNLDCQKEAAHI 359

  Fly    79 IN--QQKLDLAVQDDKLLKSLEE 99
            ||  |:::.|     :.|::|.|
 Frog   360 INAMQKRIHL-----QTLRALSE 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 36..257 CDD:238113 18/67 (27%)
prozNP_001116189.1 GLA 22..85 CDD:214503
EGF_CA 92..123 CDD:238011
FXa_inhibition 136..167 CDD:464251
Tryp_SPc 197..414 CDD:473915 24/88 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.