DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG11842

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:258 Identity:80/258 - (31%)
Similarity:109/258 - (42%) Gaps:53/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PKIISGSNASQQSAQYMAGIFN-----TTHLLCGGTIIHEDFVLTVAHCKST---QTLFVRLG-- 88
            |.||.|..|..:...:.|.:.:     .....||||:|.:..|||.|||..:   .....|||  
  Fly    71 PLIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDL 135

  Fly    89 AYNINH----PTDQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHL-DATLGKQ 148
            .::.|:    |.| ..|.:..|||::|.....|||::|:|.|.|.||....|.|:.. |..||..
  Fly   136 EFDTNNDDADPED-FDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGRLGTS 199

  Fly   149 IRYYNAFGWG------RTRNAEQSDILQ-------RIFVNRTNPMICHLYLGMSPD----PKQIC 196
               :.|.|||      ||.|.:...:..       ||..:|.:.:         |:    ..|:|
  Fly   200 ---FIAIGWGQLEIVPRTENKKLQKVKLYNYGTRCRITADRNDEL---------PEGYNATTQLC 252

  Fly   197 -ATTDQGDTCAGDSGGP-LISKITYQGKNFDTQFGITSYGTRECNGVGL---YTDVSQYSGWI 254
             .:.:..|||.|||||| ||..:.|.....  ..||||.|. .|:...|   ||.|..|..||
  Fly   253 IGSNEHKDTCNGDSGGPVLIYHMDYPCMYH--VMGITSIGV-ACDTPDLPAMYTRVHFYLDWI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 77/255 (30%)
Tryp_SPc 36..257 CDD:238113 79/256 (31%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 79/256 (31%)
Tryp_SPc 73..312 CDD:214473 77/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437620
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.