DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG4815

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:247 Identity:61/247 - (24%)
Similarity:96/247 - (38%) Gaps:53/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PKIISGSNASQQSAQYMAGI----FNTTHLLCGGTIIHEDFVLTVAHC--KSTQTLFVRLGA--- 89
            |:|.:|...:.:|   :.|:    ||...|:|..|::....:||.|||  ...::.|..:|.   
  Fly    33 PRIYNGIKTTVES---LGGVGIQLFNGRKLVCSATLLTPRHILTAAHCFENLNRSKFHVIGGKSA 94

  Fly    90 --------YNINHPTDQIRVIETIAHPQYSNSTYANDIALVKLE---RSVIFNLNIQPICIHLDA 143
                    :|.|      ::|....||:|:...:..|:|:.|.:   ||..  :....:|..:..
  Fly    95 EFTWHGNNFNKN------KLIRVQIHPKYAKMKFIADVAVAKTKYPLRSKY--IGYAQLCRSVLH 151

  Fly   144 TLGKQIRYYNAFGW---GRTRNAEQSDILQRIFVNRTNPMICHLYLGMSPDPKQICATTDQGDT- 204
            ...|.|    |.||   |...:..:....:.:.|...:...|...|.....|..|||......| 
  Fly   152 PRDKLI----AAGWGFEGGVWDESRKKTFRSMKVGIVSKRDCEKQLDRKMPPNIICAGAYNNKTL 212

  Fly   205 CAGDSGGPL--------ISKITYQ-GKNF--DTQFGITSYG---TRECNGVG 242
            |.|||||||        |:..|:: |.|.  |...|:..|.   .|..|.:|
  Fly   213 CFGDSGGPLLLGRQVCGINTWTFKCGNNEKPDVYMGVRYYAKFIKRTINRMG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 60/246 (24%)
Tryp_SPc 36..257 CDD:238113 60/245 (24%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 53/221 (24%)
Trypsin 49..256 CDD:278516 53/218 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436643
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.