DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and grass

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:288 Identity:87/288 - (30%)
Similarity:127/288 - (44%) Gaps:36/288 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FLCSLGSCQ---LAYSMFLKQ--PCGKTPVPKIISGSNASQQSAQYMAGI----FNTTHLLCGGT 64
            |.|...:.|   ...|:|..:  .||.....::.:|......|..:||.:    |..:..||||.
  Fly    87 FCCPSANIQHNSKVMSLFKDENFDCGNFLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGA 151

  Fly    65 IIHEDFVLTVAHC---KSTQTLFVRLGAYNIN---------------HPTDQIRVIETIAHPQYS 111
            :|.|.::||.|||   .......:|||.:.|:               .|...:.:.:.:.|.:|.
  Fly   152 MISERYILTAAHCVHGLQNDLYEIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYD 216

  Fly   112 NSTYANDIALVKLERSVIFNLNIQPICIHLDATL---GKQIRYYNAFGWGRTRNAEQSDILQRIF 173
            .....:||||:||.|||.|..:|:|||:.:...|   .:||..|...|||.|.|...||:|.:..
  Fly   217 ARHIMHDIALLKLNRSVPFQKHIKPICLPITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQAN 281

  Fly   174 VNRTNPMICHLYLGMSPDPKQIC-ATTDQGDTCAGDSGGPLISKITYQGKNFD--TQFGITSYGT 235
            |.......|......:....|:| ...|..|:|.|||||||.:...|.|:...  .:|||.|.|.
  Fly   282 VPLQPRSACSQAYRRAVPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGV 346

  Fly   236 RECNGV---GLYTDVSQYSGWIANIVRS 260
            ..|..:   ||||:|.:|..||.:.:.|
  Fly   347 VTCGQISLPGLYTNVGEYVQWITDTMAS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 77/249 (31%)
Tryp_SPc 36..257 CDD:238113 79/251 (31%)
grassNP_651543.1 CLIP 32..90 CDD:197829 1/2 (50%)
Tryp_SPc 121..371 CDD:238113 79/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.