DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG10232

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:272 Identity:84/272 - (30%)
Similarity:124/272 - (45%) Gaps:46/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LKQPCGKT-PVPKIISGSNASQQSAQYMAGIFNTTHLL------CGGTIIHEDFVLTVAHC---- 77
            |...||:. |:.::..|:.|......:||.:......|      |.|::|::.:|||.|||    
  Fly   244 LPTSCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKD 308

  Fly    78 KSTQTLF----VRLGAYNINHPTD------------QIRVIETIAHPQYSN-STYANDIALVKLE 125
            |...|..    ||||.::|....|            :|.:.....|.||.| |.:.:|||||:|:
  Fly   309 KMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQ 373

  Fly   126 RSVIFNLNIQPICIHLDATLGKQIRYYN----AFGWGRTRNAEQSDIL--QRIFVNRTNPMICHL 184
            ..|.:...|.|||:..|     .|..:|    ..|||.|:|.|.|.:|  ..::.||   ..|..
  Fly   374 TPVRYTHEILPICVPKD-----PIPLHNHPLQIAGWGYTKNREYSQVLLHNTVYENR---YYCQD 430

  Fly   185 YLGMSPDPKQICATTDQG-DTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNG--VGLYTD 246
            .:....:..||||:..:| |:|.|||||||:..:....::.....||.|||:..|..  .|:||.
  Fly   431 KISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCGDRKPGVYTK 495

  Fly   247 VSQYSGWI-ANI 257
            ...:..|| ||:
  Fly   496 TGAFFSWIKANL 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 76/254 (30%)
Tryp_SPc 36..257 CDD:238113 79/257 (31%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 78/253 (31%)
Tryp_SPc 260..503 CDD:214473 76/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463488
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.