DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and SPE

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:269 Identity:85/269 - (31%)
Similarity:125/269 - (46%) Gaps:43/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CGKTPVPKIISGSNASQQSAQYMA-----GIFNTTHLL-CGGTIIHEDFVLTVAHCKSTQTL--- 83
            ||.....:|..|:|.:.....:|.     .:|:.|:.. |||.:::..:|||..||.:::.|   
  Fly   127 CGFLFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKS 191

  Fly    84 -----FVRLGAYNINHPTD----------------QIRVIETIAHPQYS-NST-YANDIALVKLE 125
                 .||||.::.....|                .|.|.:.|.|..|: ||. ..||||||:|:
  Fly   192 GAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLK 256

  Fly   126 RSVIFNLNIQPICIHLDATLGKQIRYY--NAFGWGRTRNAEQSDILQRIFVNRTNPMIC---HLY 185
            |.|.:...::|||:..|..:......|  :..|||.|.|.:.|.|..:|.||..|...|   :..
  Fly   257 RIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLTENMQPSAIKLKITVNVWNLTSCQEKYSS 321

  Fly   186 LGMSPDPKQICATTDQG-DTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGV----GLYT 245
            ..:..|..|:||....| |||.|||||||:..|:..|::.....|:|||||:.| |:    |:||
  Fly   322 FKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPC-GLKGWPGVYT 385

  Fly   246 DVSQYSGWI 254
            ....:..||
  Fly   386 RTGAFIDWI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 81/260 (31%)
Tryp_SPc 36..257 CDD:238113 83/261 (32%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 83/261 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463485
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.