DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG31199

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:169 Identity:44/169 - (26%)
Similarity:68/169 - (40%) Gaps:45/169 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CGGTIIHEDFVLTVAHC-----KSTQTLFVRLGAYNIN---------------HPTDQIRVIETI 105
            |.|.::.:..||..|||     ...:...|.||.:|.:               .|:.:|::.|..
  Fly    71 CLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCVRPSQEIKLAEIA 135

  Fly   106 AHPQYSNSTYANDIALVKLERSVIFNLNIQPICIH----LDATLGKQ------IRYYNAF---GW 157
            .||.|.:.|..|.:|::.|:|......|:.|||:.    |:.||..|      :|.:..|   .|
  Fly   136 IHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSLLNETLVAQTFVVAGLRVFEDFRLKTW 200

  Fly   158 GRT--RNAEQSDILQRIFVNRTNPMIC--H-----LYLG 187
            ..|  |...||.:  :..|..:| .:|  |     .|||
  Fly   201 VNTLSRGFCQSKV--KTLVTSSN-TVCGYHKQPVAYYLG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 44/169 (26%)
Tryp_SPc 36..257 CDD:238113 44/169 (26%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 44/169 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.