DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG5246

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:266 Identity:73/266 - (27%)
Similarity:114/266 - (42%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CSLGSCQLAYSMFLKQPCGKT-PVPKIISGSNASQQSAQYMAGIFNT--THLLCGGTIIHEDFVL 72
            ||..|.::.....|....|.. |..::|.|.::....|.|...|.||  .| :|||:||...::|
  Fly    16 CSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGEH-VCGGSIIAPQWIL 79

  Fly    73 TVAHCKS--TQTLFVRLGAYNINHPTDQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQ 135
            |.|||..  .|.|.:..|..:...|..:..|..:..|..:....|.|||||:...:.::::...|
  Fly    80 TAAHCMEWPIQYLKIVTGTVDYTRPGAEYLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQ 144

  Fly   136 PICIHLDATLGKQIRYYNAFGWGRTRN-AEQSDILQRIFVNRTNPMICH--------LYLGMSPD 191
            ||.:....:|.|........|||.|:. ...|..||:|.:|..:...|.        |..|    
  Fly   145 PIKLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEG---- 205

  Fly   192 PKQICATTDQGD-TCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVG---LYTDVSQYSG 252
              .:|..|.:|: :|.|||||||:..       ..|..|:.::|  |...:|   ::..|:.|..
  Fly   206 --HVCTFTQEGEGSCHGDSGGPLVDA-------NQTLVGVVNWG--EACAIGYPDVFGSVAYYHD 259

  Fly   253 WIANIV 258
            ||..::
  Fly   260 WIEQMM 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 65/235 (28%)
Tryp_SPc 36..257 CDD:238113 67/237 (28%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 65/235 (28%)
Tryp_SPc 42..263 CDD:238113 67/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437383
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.