DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG17475

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:242 Identity:74/242 - (30%)
Similarity:106/242 - (43%) Gaps:37/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KIISGSNASQQSAQY---MAGIFNTTHLLCGGTIIHEDFVLTVAHC---KSTQTLFVRLGAYNIN 93
            ::|:|.:.....|:|   :.|::. .| :|||.||.|..|||.|||   .:...|.|..|.....
  Fly    49 RVINGEDVQLGEAKYQISLQGMYG-GH-ICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYE 111

  Fly    94 HPTDQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHLDATL-------GKQIRY 151
            .|.....|.|...|..|::..|.|||||::|..::.||...||      |.|       |.|:. 
  Fly   112 KPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQP------AELPTAPVANGTQLL- 169

  Fly   152 YNAFGWGRTRN-AEQSDILQRIFVNRTNPMICHLYLGMSPD--PKQICATTDQGD-TCAGDSGGP 212
              ..|||.|.. .:..||||:.::.......|...:...|.  |..||..|..|. .|.||||||
  Fly   170 --LTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGP 232

  Fly   213 LISKITYQGKNFDTQFGITSYGTRECNGV-GLYTDVSQYSGWIANIV 258
            |    |:.|    ..:|:.::|.....|| ..:.:|..|..||.:::
  Fly   233 L----THNG----VLYGLVNWGYPCALGVPDSHANVYYYLEWIRSMI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 72/236 (31%)
Tryp_SPc 36..257 CDD:238113 74/238 (31%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 72/236 (31%)
Tryp_SPc 50..269 CDD:238113 74/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437385
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.