DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG17477

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:273 Identity:76/273 - (27%)
Similarity:108/273 - (39%) Gaps:52/273 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YLFVWIFLCSLGSCQLAYSMFLKQPCGKTPVPKIISGSNASQQSAQYMAGIFNT--THLLCGGTI 65
            :||..:...||....||...|            |:.|.||::..|.|...:...  :| ||||.|
  Fly     6 FLFYILVFSSLYCDLLALEHF------------IVGGQNAAEGDAPYQVSLQTLLGSH-LCGGAI 57

  Fly    66 IHEDFVLTVAHCKS---TQTLFVRLGAYNINHP-----TDQIRVIETIAHPQYSNSTYANDIALV 122
            |.:.:::|..||..   |..|.|..|......|     .|.|.:     |..|.:..|.|||.|:
  Fly    58 ISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPGAVYYPDAIYL-----HCNYDSPKYQNDIGLL 117

  Fly   123 KLERSVIFNLNIQPICIHLDAT---LGKQIRYYNAFGWGRTRNAEQS--DILQRIFVNRTNPMIC 182
            .|..|:.||...|  .:.|..:   .|.....:.  ||| :::|..|  ..|||:.....|...|
  Fly   118 HLNESITFNALTQ--AVELPTSPFPRGASELVFT--GWG-SQSAAGSLPSQLQRVQQQHLNSPAC 177

  Fly   183 HLYLGMSPD----PKQICATTDQG-DTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGV- 241
            ...:....|    |..|||..... ..|.|||||||:    :||    |..||.::......|| 
  Fly   178 ESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLV----HQG----TLVGILNFFVPCAQGVP 234

  Fly   242 GLYTDVSQYSGWI 254
            .::.::..|..|:
  Fly   235 DIFMNIMYYRDWM 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 68/239 (28%)
Tryp_SPc 36..257 CDD:238113 69/240 (29%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 69/240 (29%)
Tryp_SPc 27..246 CDD:214473 68/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.