DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG9649

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:274 Identity:72/274 - (26%)
Similarity:115/274 - (41%) Gaps:68/274 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CGKTPV---PKIISGSNASQQSAQYMAGIFNTT----HLLCGGTIIHEDFVLTVAHCKSTQTLFV 85
            ||:..|   |.|.:|....:....:||.:|...    :.|||||:|....|::.|||       .
  Fly   246 CGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHC-------F 303

  Fly    86 RLGAYNINHPTDQ------------------IRVIETIAHPQYSNSTYAN-DIALVKLERSVIFN 131
            |.|:.|:  |.::                  :.|...:.|.||:.:.|.: |:||::|...|...
  Fly   304 RFGSRNL--PGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNVYTDADLALLQLSNHVDIG 366

  Fly   132 LNIQPICIHLDATLGKQIRYYNAF--GWG-------RTRNAEQSD---ILQ---RIFVNRTNPMI 181
            ..|:|||:..:..|.:....:.::  |||       .||.|:.:|   |.|   |..::..|...
  Fly   367 DYIKPICLWNENFLLELPSGHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKF 431

  Fly   182 CHLYLGMSPDPKQICATTDQGD-TCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVGL-- 243
            ...:        .|||:..|.. .|:|||||.|:    .|.::.....|:.|.|.|..|...|  
  Fly   432 ITSH--------TICASNAQASGPCSGDSGGGLM----LQEQDIWMLRGVVSAGQRMTNRCNLTL 484

  Fly   244 ---YTDVSQYSGWI 254
               ||||:::..|:
  Fly   485 PVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 67/262 (26%)
Tryp_SPc 36..257 CDD:238113 68/263 (26%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 67/261 (26%)
Tryp_SPc 259..497 CDD:214473 66/258 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436610
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.