DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG13318

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:283 Identity:73/283 - (25%)
Similarity:113/283 - (39%) Gaps:46/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTYLFVWIFLCSLGSCQLAYSMFLKQPCGKTPVPKIISGSNASQQSAQYMAGIFNTTHL-LCGGT 64
            :|..:..:..|..||.|.. ..|...|...|..|     ..||..:..:.|.:..|..: |.||.
  Fly   134 LTCSYGLVACCQAGSYQCG-RRFPPPPGSTTAAP-----GQASFGAYPWQAALLTTADVYLGGGA 192

  Fly    65 IIHEDFVLTVAH--CKSTQTLF-VRLGAYNINH-----PTDQIRVIETIAHPQYSNSTYANDIAL 121
            :|....|||.||  .....|.| ||||.::...     |...:.:.....:|.::.:...||:|:
  Fly   193 LITAQHVLTAAHKVYNLGLTYFKVRLGEWDAASTSEPIPAQDVYISNVYVNPSFNPNNLQNDVAI 257

  Fly   122 VKLER--SVIFNLNIQPICIHLDATLGKQIRYYNAFGWGR----TRNAEQSDILQRIFVNRTNPM 180
            :||..  |:.....:..:|:...:.:|:  |.:.| |||:    ...|.|: |.:::.|    |:
  Fly   258 LKLSTPVSLTSKSTVGTVCLPTTSFVGQ--RCWVA-GWGKNDFGATGAYQA-IERQVDV----PL 314

  Fly   181 I----CHLYLG---------MSPDPKQICATTDQG-DTCAGDSGGPLISKITYQGKNFDTQFGIT 231
            |    |...|.         :|| ...|||..:.| |.|.||.|.||:  .|..|..:.......
  Fly   315 IPNANCQAALQATRLGSSFVLSP-TSFICAGGEAGKDACTGDGGSPLV--CTSNGVWYVVGLVAW 376

  Fly   232 SYGTRECNGVGLYTDVSQYSGWI 254
            ..|..:....|:|.:|..|..||
  Fly   377 GIGCAQAGVPGVYVNVGTYLPWI 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 62/247 (25%)
Tryp_SPc 36..257 CDD:238113 64/248 (26%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 64/242 (26%)
Tryp_SPc 169..399 CDD:214473 62/240 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435548
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.