DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and MP1

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:277 Identity:84/277 - (30%)
Similarity:128/277 - (46%) Gaps:50/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CGKTPVPKIISGSNASQQSAQYMAGIFNTT-------HLLCGGTIIHEDFVLTVAHCKST----- 80
            ||:....:::.|:..:::...:||.|..|.       |  |||::|:..:|||.|||.|.     
  Fly   130 CGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHH--CGGSLINHRYVLTAAHCVSAIPSDW 192

  Fly    81 QTLFVRLGAY----------------NINHPTDQIRVIETIAHPQYSNST--YANDIALVKLERS 127
            :...||||.:                :.|.|.....|.|.|.||||..::  ..|||||::|...
  Fly   193 ELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDE 257

  Fly   128 VIFNLNIQPICI------HLDATLGKQIRYYNAFGWGRTRNAEQSDILQRIFVNRTNPMICHLYL 186
            |.::..|.|:|:      |.:..||:::   ...|||||.....|:|..:..::......|:...
  Fly   258 VQYSDFILPVCLPTLASQHNNIFLGRKV---VVAGWGRTETNFTSNIKLKAELDTVPTSECNQRY 319

  Fly   187 G---MSPDPKQICATTDQG-DTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGV----GL 243
            .   .:...||:||...:| |:|.|||||||:.:....|.:.....|:.|||...| |:    |:
  Fly   320 ATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPC-GLKGWPGV 383

  Fly   244 YTDVSQYSGWIANIVRS 260
            ||.|..|..||.|.||:
  Fly   384 YTRVEAYLNWIENNVRA 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 77/262 (29%)
Tryp_SPc 36..257 CDD:238113 79/264 (30%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 77/262 (29%)
Tryp_SPc 138..397 CDD:238113 79/264 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463493
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.