DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG14088

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:276 Identity:82/276 - (29%)
Similarity:125/276 - (45%) Gaps:39/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IFLCSLGSCQLAYSMFLKQPCGKTP---VPKIISGSNASQQSAQYMAGIFNTTHLLCGGTIIHED 69
            |||...||.|     ||...||:..   .|.|:....|.......:.|:         ||:|||.
  Fly    16 IFLSGTGSAQ-----FLGNICGERRDGLSPDIVGPWTAILHHFGRIVGV---------GTLIHER 66

  Fly    70 FVLTVAHC-KSTQTLFVRLGAY-NINHPTDQIRVIET-IAHPQYSNSTYANDIALVKLERSVIFN 131
            |:||..|| .|...:..|||.| .|.....:..::.. .::..::..|.||::.|:||.|:|::.
  Fly    67 FILTDVHCGDSIGVIRARLGEYGRIGSELAEDHIVAAFFSNANFNPETQANNMGLMKLLRTVVYK 131

  Fly   132 LNIQPICIHLDA---TLGKQIRYYNAFGWGRTRNAEQSDILQRIFVNRTNPMICHLYLGMSPDPK 193
            .:|.|:||.:|:   |...::.|:|...|   :|:::|.:|:...|.|. |..|.     ..|..
  Fly   132 EHIIPVCILMDSRMQTFADELDYFNGTTW---KNSDKSPMLRSKTVIRM-PQACG-----KLDHG 187

  Fly   194 QICATTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVGLYTDVSQYSGWIANIV 258
            |.||.....|:|...||..|..:|.|.|.|....|||.:....:|:....||||.|...||:.::
  Fly   188 QFCAGHKDLDSCDEPSGAALTREIDYIGPNRTVLFGIANSVEVKCSNSRTYTDVVQLHQWISMVI 252

  Fly   259 RSKQDRSVVSRRSNGM 274
            .|       |..::||
  Fly   253 YS-------SNTNDGM 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 65/224 (29%)
Tryp_SPc 36..257 CDD:238113 67/226 (30%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 67/226 (30%)
Tryp_SPc 42..248 CDD:214473 65/223 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.