Sequence 1: | NP_001246396.1 | Gene: | CG43110 / 12798330 | FlyBaseID: | FBgn0262570 | Length: | 483 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649077.1 | Gene: | CG18223 / 40068 | FlyBaseID: | FBgn0036832 | Length: | 322 | Species: | Drosophila melanogaster |
Alignment Length: | 267 | Identity: | 70/267 - (26%) |
---|---|---|---|
Similarity: | 101/267 - (37%) | Gaps: | 87/267 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 AQYMAGI--------FNTTHLLCGGTIIHEDFVLTVAHC------------------------KS 79
Fly 80 TQTLFVRLGAYNINHPTDQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPI--CIHLD 142
Fly 143 ATLGKQIRYYNAFGWGRTRNAE--QSDILQRIFVNRTNPMIC----HLYLGMSPDPKQICA---- 197
Fly 198 -TTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVG------LYTDVSQYSGWIA 255
Fly 256 NIVRSKQ 262 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG43110 | NP_001246396.1 | Tryp_SPc | 35..254 | CDD:214473 | 67/257 (26%) |
Tryp_SPc | 36..257 | CDD:238113 | 69/260 (27%) | ||
CG18223 | NP_649077.1 | Tryp_SPc | 60..283 | CDD:238113 | 68/258 (26%) |
Tryp_SPc | 60..280 | CDD:214473 | 66/255 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45437382 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |