DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG11529

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:225 Identity:73/225 - (32%)
Similarity:104/225 - (46%) Gaps:43/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LLCGGTIIHEDFVLTVAHCKSTQTLF-VRLGAYNINHPTDQ----IRVIETIAHPQYSNSTYAND 118
            :|||||::.:.::||..||....|.: |.||..::......    :|..:.|.|.:::..|.|||
  Fly    57 ILCGGTLLDKRWILTAGHCTMGVTHYDVYLGTKSVEDTEVSGGLVLRSNKFIVHERFNPETAAND 121

  Fly   119 IALVKLERSVIFNLNIQPICIHLDATLGKQIRYYN-------AFGWGRTRNAEQSDILQRIFVNR 176
            ||||||.:.|.|...|||      |:|..:.|:..       |.|||.......||.:|...:..
  Fly   122 IALVKLPQDVAFTPRIQP------ASLPSRYRHDQFAGMSVVASGWGAMVEMTNSDSMQYTELKV 180

  Fly   177 TNPMICH-----LYLGMSPDPKQICATTDQGDT-CAGDSGGPLISKITYQGKNFDTQF--GITSY 233
            .:...|.     :..|:      |||...:.:| |.|||||||:.|        |||.  ||||:
  Fly   181 ISNAECAQEYDVVTSGV------ICAKGLKDETVCTGDSGGPLVLK--------DTQIVVGITSF 231

  Fly   234 GTR---ECNGVGLYTDVSQYSGWIANIVRS 260
            |..   |.|..|.:|.|:.|..||.:.:.|
  Fly   232 GPADGCETNIPGGFTRVTHYLDWIESKIGS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 70/217 (32%)
Tryp_SPc 36..257 CDD:238113 72/220 (33%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 72/220 (33%)
Tryp_SPc 37..255 CDD:214473 70/217 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.