DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG18180

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:275 Identity:73/275 - (26%)
Similarity:114/275 - (41%) Gaps:49/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IFLCSLGSCQLAYSMFLKQPCG--KTPV------PKIISGSNASQQSAQYMAGIF-----NTTHL 59
            :||.:|.:   |.::....|.|  :|.:      .:|::|..|.:..|.|:.|:|     :.:..
  Fly     3 LFLLTLSA---ALALVAASPTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGA 64

  Fly    60 LCGGTIIHEDFVLTVAHCKSTQTLFVRL-------GAYNINHPTDQIRVIETIAHPQYSNSTYAN 117
            :..||||..|::||.|||.:...:.:..       |||.     ..:|....|:||.:. |....
  Fly    65 VGAGTIIANDWILTAAHCLTGDYVEIHYGSNWGWNGAYR-----QTVRRDNFISHPDWP-SQGGR 123

  Fly   118 DIALVKLERSVIFN--LNIQPICIHLDATLGKQIRYYN-----AFGWGRTRNAEQSDILQRIFVN 175
            ||.|::... |.||  :|..|:     .::.:|...|.     |.|||...|...:|.||.:.|.
  Fly   124 DIGLIRTPH-VDFNGLINKIPL-----PSMNEQNDRYQDTWCVACGWGGMDNGNLADWLQCVDVQ 182

  Fly   176 RTNPMICHLYLGMSPDPKQICATTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTREC-N 239
            ..:...|....|............|....|.|||||||   :|:.....   .|:.::.:..| :
  Fly   183 IISNSECEQAYGSVASTDMCTRHADGKSVCGGDSGGPL---VTHDNARL---VGVITFASVSCHD 241

  Fly   240 GVGLYTDVSQYSGWI 254
            |...||.||.|..||
  Fly   242 GPSGYTRVSDYLEWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 64/238 (27%)
Tryp_SPc 36..257 CDD:238113 66/239 (28%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 64/238 (27%)
Tryp_SPc 36..259 CDD:238113 66/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435851
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.