DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG8329

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:259 Identity:69/259 - (26%)
Similarity:108/259 - (41%) Gaps:37/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GKTPVPKIISGSNASQQSAQYMAGIFNTTHLLCGGTIIHEDFVLTVAHCKSTQTLFVRLG---AY 90
            |..|...|::|..|.:..|.|..|:......:.||::|..::|||.|||.:|.::.:..|   |:
  Fly    28 GGGPKDIIVNGYPAYEGKAPYAVGLRMNNGAVGGGSVIGNNWVLTAAHCLTTDSVTIHYGSNRAW 92

  Fly    91 N--INHPTDQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHLDATLGKQIRYYN 153
            |  :.|..::.....   ||.|.||. .:||.|::.......|| |..:.:...:..|:  |:.|
  Fly    93 NGQLQHTVNKNNFFR---HPGYPNSA-GHDIGLIRTPYVSFTNL-INKVSLPKFSQKGE--RFEN 150

  Fly   154 ----AFGWGRTRNAEQSDILQRIFVNRTNPMICHLYLGMSPDPKQICATTDQGDTCAGDSGGPLI 214
                |.|||...|...:|.||.:.|...:...|....|...........||....|.|||||.|:
  Fly   151 WWCVACGWGGMANGGLADWLQCMDVQVISNGECARSYGSVASTDMCTRATDGKSVCGGDSGGALV 215

  Fly   215 SKITYQGKNFDTQFGITSYGTREC-NGVGLYTDVSQYSGWIANIVRSKQDRSVVSRRSNGMFLY 277
            :      .:...|.|:.::.:..| :|...||.||.:..||              |..:|:..|
  Fly   216 T------HDNPIQVGVITFASIGCKSGPSGYTRVSDHLDWI--------------REKSGIAYY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 62/228 (27%)
Tryp_SPc 36..257 CDD:238113 64/230 (28%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 65/244 (27%)
Tryp_SPc 35..250 CDD:214473 62/227 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435917
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.