DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:242 Identity:74/242 - (30%)
Similarity:104/242 - (42%) Gaps:35/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KIISGSNASQQSAQYMAGIFNTTHLL----CGGTIIHEDFVLTVAHC-KSTQTLFVRLGA----- 89
            :|..||||:.....|..|:......|    |||::|...:|||.||| ...|::.|.|||     
  Fly    37 RITGGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTS 101

  Fly    90 YNINHPTDQIRVIETIAHPQYSNSTYANDIALVKL----ERSVIFNLNIQPICIHLDATLGKQIR 150
            ..|.|   .:...:.|.|..::::...|||:|:|:    ..|.|..:.:..|.......:|.   
  Fly   102 AEITH---TVSSSDIIIHSGWNSANLRNDISLIKIPATSSSSRISAVKLPSISNSYSTFVGD--- 160

  Fly   151 YYNAFGWGRTRNAEQSDILQRIFVNR---TNPMICHLYLGMS--PDPKQICATTDQGDTCAGDSG 210
            ...|.|||||.:..........:|:.   ||......| |.|  .|.....||||...||.||||
  Fly   161 VAVASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQTY-GTSVVTDSTLCVATTDAKSTCNGDSG 224

  Fly   211 GPLISKITYQGKNFDTQFGITSYGTR---ECNGVGLYTDVSQYSGWI 254
            |||:.|.:.:      |.|:||:|..   |......:|.|:.|..||
  Fly   225 GPLVLKSSSE------QIGLTSFGASAGCEKGYPAAFTRVTSYLDWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 72/240 (30%)
Tryp_SPc 36..257 CDD:238113 74/241 (31%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 72/240 (30%)
Tryp_SPc 38..268 CDD:238113 74/241 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436280
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.