DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and yip7

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:277 Identity:73/277 - (26%)
Similarity:115/277 - (41%) Gaps:36/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTYLFVWIFLCSLGSCQLAYSMFLKQPCGKTPVP----KIISGSNASQQSAQYMAGI-FNTT--H 58
            |....|.:...:..|..|..::....|..:...|    :|.:|.:|......|..|: |:::  .
  Fly     1 MKVFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGS 65

  Fly    59 LLCGGTIIHEDFVLTVAHC-KSTQTLFVRLGAYNINHP--TDQIRVIETIAHPQYSNSTYANDIA 120
            ..|||:||..::|||.||| ....::.:..||.....|  |..:...:...|..|...|..|||:
  Fly    66 WWCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALTIRNDIS 130

  Fly   121 LVKLERSVIFNLNIQPICIHLDATLGKQIRYYN----AFGWGRTRNAEQSDILQR--IFVNRT-- 177
            |::.. ||.|:..:..  |.|.|.......|..    |.|||.|  ::|:..:.|  .:|:.|  
  Fly   131 LIQTS-SVSFSATVNK--ISLPAVSNSYSTYEGKTAVASGWGLT--SDQATAVSRDLQYVDLTII 190

  Fly   178 -NPMICHLYLGMSPDPKQICA-TTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTR---E 237
             |......:..:....:.:|. ||::..||.|||||||    ...|    ...|.||:|:.   |
  Fly   191 SNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPL----ALDG----VLIGATSFGSADGCE 247

  Fly   238 CNGVGLYTDVSQYSGWI 254
            ......:|.::.|..||
  Fly   248 SGAPAAFTRITYYRDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 65/237 (27%)
Tryp_SPc 36..257 CDD:238113 67/238 (28%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 65/237 (27%)
Tryp_SPc 40..267 CDD:238113 67/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436181
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.