DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG13527

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:275 Identity:67/275 - (24%)
Similarity:105/275 - (38%) Gaps:84/275 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IISGSNASQ-------------QSAQYMAGI--------FNTTHLLCGGTIIHEDFVLTVAHCKS 79
            |:||::..:             :.|:|:..|        |...| .|||.::...:|:|.|||. 
  Fly    17 ILSGAHRMKRLSSPKFHGDETLELAKYVVSIRSRTPNKYFGDNH-YCGGGLLSNQWVITAAHCV- 79

  Fly    80 TQTLFVRLGAYNINHPTDQIRVI------------ETIAHPQYS-----NSTYAN--DIALVKLE 125
                   :|...|.:....:.|:            :::..|..|     |.|..|  ::||:||:
  Fly    80 -------MGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNFTMHNTFNMALMKLQ 137

  Fly   126 RSVIFNLNIQPIC--IHLDATLGKQIRYYNAFGWGRTRNAEQSDI-LQRIFVNRTNPMICHLYL- 186
            ..:..|   .|..  :||.....|....:...||||........: :.::.|...:..:|..|. 
  Fly   138 EKMPSN---DPRIGFLHLPKEAPKIGIRHTVLGWGRMYFGGPLAVHIYQVDVVLMDNAVCKTYFR 199

  Fly   187 ----GMSPDPKQICA----TTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSY--GTRECNGV 241
                ||      :||    .|...:.|:||.|.||:|     ||   ...||.:|  |....|..
  Fly   200 HYGDGM------MCAGNNNWTIDAEPCSGDIGSPLLS-----GK---VVVGIVAYPIGCGCTNIP 250

  Fly   242 GLYTDVSQYSG--WI 254
            .:||||  :||  ||
  Fly   251 SVYTDV--FSGLRWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 65/273 (24%)
Tryp_SPc 36..257 CDD:238113 67/275 (24%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 63/249 (25%)
Tryp_SPc 43..263 CDD:214473 61/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.