DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG30283

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:267 Identity:91/267 - (34%)
Similarity:134/267 - (50%) Gaps:11/267 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TYLFVWIFLCSLGSCQLAYS---MFLKQPCGKTPVP--KIISGSNASQQSAQYMAGIFNTTHLLC 61
            |.:||.:.|.:..|..:..|   .||:.|||..|:.  ||:.|.||...||.:||.:.......|
  Fly     4 TKIFVVVVLLAASSVVVLGSESGSFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGGFHC 68

  Fly    62 GGTIIHEDFVLTVAHCKSTQTLFVRLGAYNINHPTDQIRVIETIAHPQYSNSTYANDIALVKLER 126
            |||:|...||||.|||.:...|.||||.........:..|.....|..|....:  |:||::|.:
  Fly    69 GGTLITNRFVLTSAHCIANGELKVRLGVLEREAEAQKFAVDAMFVHTDYYFDQH--DLALLRLAK 131

  Fly   127 SVIFNLNIQPICIHLD---ATLGKQIRYYNAFGWGRTRNAEQSDILQRIFVNRTNPMIC-HLYLG 187
            .|.::.||.|||:.||   ..:.:.|..:..:|||:|.:...|.:||:..:...:...| ..|..
  Fly   132 RVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLHRSECAKQYPH 196

  Fly   188 MSPDPKQICATTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVGLYTDVSQYSG 252
            ...:...|||.:...:||.|||||||.:.:||.......|||:||:|..:|:...::|:|..:..
  Fly   197 QQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKATVFTNVMTHLD 261

  Fly   253 WIANIVR 259
            ||.|.||
  Fly   262 WIVNTVR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 74/222 (33%)
Tryp_SPc 36..257 CDD:238113 75/224 (33%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 74/222 (33%)
Tryp_SPc 43..266 CDD:238113 75/224 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I7012
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.