DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and CG1773

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster


Alignment Length:308 Identity:98/308 - (31%)
Similarity:136/308 - (44%) Gaps:76/308 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VWIFLCSLGSCQ---------------LAYSMFLKQPCG--KTPVP------KIISGSNASQQSA 47
            :|..||.  ||.               |||....:|.||  ...:|      :|..|..:|..|.
  Fly    11 IWGILCL--SCPPSSQAGREDWTPHELLAYEQLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQ 73

  Fly    48 QYMAGIFNTTHL-------LCGGTIIHEDFVLTVAH----CKSTQTLFVRLGAYNINH------- 94
            .:||.:    |:       .|||:::.|.||||.||    |..::.:.|.||..:|:.       
  Fly    74 PWMAFL----HISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVTY 134

  Fly    95 --------PTDQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHL-DATLGKQIR 150
                    |.::..:.:.|.|.:::......||||:||.:.|:|..:|:|||:.| |..|...::
  Fly   135 NYQRVCALPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQ 199

  Fly   151 Y---YNAFGWGRTRNAEQSDILQRIFVNRTNPMICHLYLGMSPDPKQ---ICATTDQGDTCAGDS 209
            .   |.|.|||||.:        |.|.|.|  |..|:......|.:.   :||..|..|||.|||
  Fly   200 LGQSYMAVGWGRTES--------RRFANST--MEVHINTEKCTDGRDTSFLCANGDYVDTCTGDS 254

  Fly   210 GGPLISKITYQGKNFDTQFGITSYGTRECNGVG---LYTDVSQYSGWI 254
            |||||.|.|..||....|||:.|.|::.| |.|   .|.||..|..||
  Fly   255 GGPLIWKTTLFGKARTVQFGVVSTGSQNC-GAGQKAYYMDVPTYVPWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 84/254 (33%)
Tryp_SPc 36..257 CDD:238113 86/255 (34%)
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 84/254 (33%)
Tryp_SPc 62..301 CDD:238113 84/253 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.