DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and Jon44E

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:291 Identity:81/291 - (27%)
Similarity:122/291 - (41%) Gaps:70/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LFVWIFLCSLGSCQLAYSMFLKQPCGKTPVP----------KIISGSNASQQSAQYMAGI-FNTT 57
            |||::...::.|..:..|    :.....||.          :|.:|..|.:....|:.|: ||..
  Fly     3 LFVFLACLAVASAGVVPS----ESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDG 63

  Fly    58 HLLCGGTIIHEDFVLTVAHC-KSTQTLFVRLGAYNINHP---TDQIRVIETIAHPQYSNSTYAND 118
            ...|||:||...:|||.||| .|...:.:..|| :..|.   |..:...:.|.||.: |....||
  Fly    64 GYWCGGSIIDHTWVLTAAHCTNSANHVLIYFGA-SFRHEAQYTHWVSRSDMIQHPDW-NDFLNND 126

  Fly   119 IALVKLERSVIFNLNIQPICIHLD--ATLGK-QIRYYN------------AFGWGRT-RNAEQSD 167
            |||:::.              |:|  :.:.| ::..||            |.|||.| .|:..|:
  Fly   127 IALIRIP--------------HVDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSN 177

  Fly   168 ILQRIFVNRTNPMICHLYLGMS-PDPKQICATTDQG-DTCAGDSGGPLI----SKITYQGKNFDT 226
            .|..:.|...:...|..|.|.: .....||..||.| .:|:|||||||:    ::|.        
  Fly   178 YLNCVDVQIIDNNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGPLVLHDNNRIV-------- 234

  Fly   227 QFGITSYGTRECNGVGL---YTDVSQYSGWI 254
              ||.|:|:.|....|.   :|.|:.|..||
  Fly   235 --GIVSFGSGEGCTAGRPAGFTRVTGYLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 72/248 (29%)
Tryp_SPc 36..257 CDD:238113 74/249 (30%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 72/248 (29%)
Tryp_SPc 41..266 CDD:238113 74/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435686
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.