DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and try-9

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:223 Identity:51/223 - (22%)
Similarity:86/223 - (38%) Gaps:69/223 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GTIIHEDFVLTVAH-----------CKS---TQTLFVR-----LGAYNIN----------HPTDQ 98
            ||::....::|.||           |.:   .:..|||     :...|:.          |..|.
 Worm    30 GTLVSPWHIVTAAHLIGISEDPLPDCDTGNLREAYFVRDYKNFVAFVNVTCAVPEMCKGLHRKDM 94

  Fly    99 IR--VIETIAHPQYSNSTYA----------NDIALVKLERSVIFNLNIQPICIHLDATLGKQIRY 151
            .:  .|:::    |....|.          ||||:.:||..:.|:.:|.|.|:. .|....:||.
 Worm    95 FKPLAIKSL----YIRKGYVGDGCIDRESFNDIAVFELEEPIEFSKDIFPACLP-SAPKIPRIRE 154

  Fly   152 --YNAFGWGRTRNAEQSD-ILQRIFVNRTNPMICHLYLGMS------PDPKQIC-ATTDQGDTCA 206
              |..||:||    :.|| :|:       :..:..||..::      |.....| :..::|.:|.
 Worm   155 TGYKLFGYGR----DPSDSVLE-------SGKLKSLYSFVAECSDDFPYGGVYCTSAVNRGLSCD 208

  Fly   207 GDSGGPLISKITYQGKNFDTQFGITSYG 234
            ||||..::.  |...:|.....|:.|.|
 Worm   209 GDSGSGVVR--TSDTRNVQVLVGVLSAG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 51/223 (23%)
Tryp_SPc 36..257 CDD:238113 51/223 (23%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 51/223 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.