DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and scaf

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:185 Identity:55/185 - (29%)
Similarity:86/185 - (46%) Gaps:31/185 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LLCGGTIIHEDFVLTVAHCKS---TQTLFVRLGAYNI---NHPTD-QIRVIETI-AHPQYSNSTY 115
            |:|||.||.:.|||:.|.|.:   ...:.|:.|.:.:   |.|.. |:..::|: .||.|..||.
  Fly   448 LICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLPFQLTGVKTVDVHPDYDPSTN 512

  Fly   116 ANDIALVKLERSVIFNLNIQPICIHLDATLGKQIRYYNAFGWGRTRNA--EQSDILQRIFVNRTN 178
            ::|:|:::|||.:.|..:||||||..:..  |........|||:...:  |:..::.   |..|.
  Fly   513 SHDLAIIRLERRLEFASHIQPICISDEDP--KDSEQCFTSGWGKQALSIHEEGALMH---VTDTL 572

  Fly   179 PMI---CHLYLGMSPDPKQICATT-------DQGDTCAGDSGGPLISKITYQGKN 223
            |..   |      |.|...:|:.|       |.|...|..||..:..|..:.|:|
  Fly   573 PQARSEC------SADSSSVCSATKFDSCQFDVGSALACGSGSSVRLKGIFAGEN 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 55/185 (30%)
Tryp_SPc 36..257 CDD:238113 55/185 (30%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 53/178 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435515
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.