DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43110 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:233 Identity:65/233 - (27%)
Similarity:103/233 - (44%) Gaps:24/233 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KIISGSNASQQSAQYMAGI--FNTTHLLCGGTIIHEDFVLTVAHC-KSTQTLFVRLGA-YNINHP 95
            :|::|..|.:..|.|..|:  .......|||:||..|:|||.||| .....:.:..|| :..|..
  Fly    36 RIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQ 100

  Fly    96 -TDQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHLDATLGKQIRYYN----AF 155
             |..:...:.|.:..:.|.. .|||||::......:::..:   :.|.:...:...|.|    |.
  Fly   101 FTHTVGSGDFIQNHNWPNQN-GNDIALIRTPHVDFWHMVNK---VELPSFNDRYNMYDNYWAVAC 161

  Fly   156 GWGRTRNAEQSDILQRIFVNRTNPMICHLYLGMSPDPKQICATTDQG-DTCAGDSGGPLISKITY 219
            |||.|....|.|.::.:.:...:...|....|..|| ..:|.:|..| .||:|||||||   :.:
  Fly   162 GWGLTTAGSQPDWMECVDLQIISNSECSRTYGTQPD-GILCVSTSGGKSTCSGDSGGPL---VLH 222

  Fly   220 QGKNFDTQFGITSYGTRECNGVGL---YTDVSQYSGWI 254
            .|...   .|:||:.:......||   :|.|:....||
  Fly   223 DGGRL---VGVTSWVSGNGCTAGLPSGFTRVTNQLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 63/231 (27%)
Tryp_SPc 36..257 CDD:238113 65/232 (28%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 63/231 (27%)
Tryp_SPc 37..260 CDD:238113 65/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435950
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.